Class b: All beta proteins [48724] (174 folds) |
Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families) |
Family b.2.2.0: automated matches [191610] (1 protein) not a true family |
Protein automated matches [191113] (3 species) not a true protein |
Species Clostridium thermocellum [TaxId:1515] [189176] (3 PDB entries) |
Domain d2wobc_: 2wob C: [169523] automated match to d1g43a_ complexed with ca |
PDB Entry: 2wob (more details), 2 Å
SCOPe Domain Sequences for d2wobc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wobc_ b.2.2.0 (C:) automated matches {Clostridium thermocellum [TaxId: 1515]} anasisvsykcgvkdgtkntiratinikntgttpvnlsdikvrywftsdgneqnnfvcdy aafgtdkvkgivkkiensvpgadtyceisftedagrlapggstgtipfriegaaeydqtd dysynsemsddfgdntkitayikdklkygveaa
Timeline for d2wobc_: