SCOPe 2.08: Domain d2wobc1: 2wob C:9-159

Lineage for d2wobc1 (2wob C:9-159)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.0: automated matches [191610] (1 protein)
   not a true family

6. Protein automated matches [191113] (13 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:1515] [189176] (12 PDB entries)

8. Domain d2wobc1: 2wob C:9-159 [169523]
   Other proteins in same PDB: d2woba2, d2wobc2, d2wobe2
   automated match to d1g43a_
   complexed with ca

Details for d2wobc1

PDB Entry: 2wob, 2 Å

PDB Description: 3b' carbohydrate-binding module from the cel9v glycoside hydrolase from clostridium thermocellum. orthorhombic structure

PDB Compounds: (C:) glycoside hydrolase, family 9

SCOPe Domain Sequences for d2wobc1:

Sequence; same for both SEQRES and ATOM records:

>d2wobc1 b.2.2.0 (C:9-159) automated matches {Clostridium thermocellum [TaxId: 1515]}
anasisvsykcgvkdgtkntiratinikntgttpvnlsdikvrywftsdgneqnnfvcdy
aafgtdkvkgivkkiensvpgadtyceisftedagrlapggstgtipfriegaaeydqtd
dysynsemsddfgdntkitayikdklkygve

Timeline for d2wobc1:

• d2wobc1 first appeared in SCOPe 2.01, called d2wobc_
  
• d2wobc1 appears in SCOPe 2.07