Lineage for d2woaa_ (2woa A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1034471Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1034472Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1034832Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 1034947Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 1034948Species Human (Homo sapiens) [TaxId:9606] [69781] (29 PDB entries)
    Uniprot P39900 106-263 ! Uniprot P39900 106-264
  8. 1034980Domain d2woaa_: 2woa A: [169518]
    automated match to d1os2a_
    complexed with 023, 576, ca, gol, so4, zn

Details for d2woaa_

PDB Entry: 2woa (more details), 2.26 Å

PDB Description: mmp12 complex with a beta hydroxy carboxylic acid
PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d2woaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2woaa_ d.92.1.11 (A:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
rgahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
glghssdpkavmfptykyvdintfrlsaddirgiqslygdpke

SCOPe Domain Coordinates for d2woaa_:

Click to download the PDB-style file with coordinates for d2woaa_.
(The format of our PDB-style files is described here.)

Timeline for d2woaa_: