SCOPe 2.04: Domain d2wo9d_: 2wo9 D:

Lineage for d2wo9d_ (2wo9 D:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Macrophage elastase (MMP-12) [69780] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69781] (36 PDB entries)
   Uniprot P39900 106-263 ! Uniprot P39900 106-264

8. Domain d2wo9d_: 2wo9 D: [169517]
   automated match to d1os2a_
   complexed with 023, 068, ca, gol, so4, zn

Details for d2wo9d_

PDB Entry: 2wo9, 1.7 Å

PDB Description: mmp12 complex with a beta hydroxy carboxylic acid

PDB Compounds: (D:) Macrophage metalloelastase

SCOPe Domain Sequences for d2wo9d_:

Sequence; same for both SEQRES and ATOM records:

>d2wo9d_ d.92.1.11 (D:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslygdp

Timeline for d2wo9d_:

• d2wo9d_ first appeared in SCOPe 2.01
  
• d2wo9d_ appears in SCOPe 2.03
  
• d2wo9d_ appears in SCOPe 2.05
  
• d2wo9d_ appears in the current release, SCOPe 2.07