Lineage for d1eiaa1 (1eia A:148-222)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706465Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2706466Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)
  6. 2706467Protein EIAV capsid protein p26 [47355] (1 species)
  7. 2706468Species Equine infectious anemia virus [TaxId:11665] [47356] (2 PDB entries)
  8. 2706471Domain d1eiaa1: 1eia A:148-222 [16951]
    Other proteins in same PDB: d1eiaa2

Details for d1eiaa1

PDB Entry: 1eia (more details), 2.7 Å

PDB Description: x-ray crystal structure of equine infectious anemia virus (eiav) capsid protein p26
PDB Compounds: (A:) eiav capsid protein p26

SCOPe Domain Sequences for d1eiaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eiaa1 a.28.3.1 (A:148-222) EIAV capsid protein p26 {Equine infectious anemia virus [TaxId: 11665]}
pkaqnirqgakepypefvdrllsqikseghpqeiskfltdtltiqnaneecrnamrhlrp
edtleekmyacrdig

SCOPe Domain Coordinates for d1eiaa1:

Click to download the PDB-style file with coordinates for d1eiaa1.
(The format of our PDB-style files is described here.)

Timeline for d1eiaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1eiaa2