Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.1: Penicillin synthase-like [51198] (5 proteins) common fold is rather distorted |
Protein automated matches [190217] (4 species) not a true protein |
Species Emericella nidulans [TaxId:162425] [186976] (12 PDB entries) |
Domain d2wo7a_: 2wo7 A: [169509] automated match to d1bk0a_ complexed with asv, fe2 |
PDB Entry: 2wo7 (more details), 2.5 Å
SCOPe Domain Sequences for d2wo7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wo7a_ b.82.2.1 (A:) automated matches {Emericella nidulans [TaxId: 162425]} svskanvpkidvsplfgddqaakmrvaqqidaasrdtgffyavnhginvqrlsqktkefh msitpeekwdlairaynkehqdqvragyylsipgkkavesfcylnpnftpdhpriqaktp thevnvwpdetkhpgfqdfaeqyywdvfglssallkgyalalgkeenffarhfkpddtla svvlirypyldpypeaaiktaadgtklsfewhedvslitvlyqsnvqnlqvetaagyqdi eaddtgylincgsymahltnnyykapihrvkwvnaerqslpffvnlgydsvidpfdprep ngksdreplsygdylqnglvslinkngqt
Timeline for d2wo7a_: