![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
![]() | Family c.1.10.1: Class I aldolase [51570] (13 proteins) the catalytic lysine forms schiff-base intermediate with substrate possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels |
![]() | Protein automated matches [190095] (28 species) not a true protein |
![]() | Species Escherichia coli [TaxId:469008] [189446] (6 PDB entries) |
![]() | Domain d2wo5d_: 2wo5 D: [169508] Other proteins in same PDB: d2wo5a2 automated match to d1hl2a_ |
PDB Entry: 2wo5 (more details), 2.2 Å
SCOPe Domain Sequences for d2wo5d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wo5d_ c.1.10.1 (D:) automated matches {Escherichia coli [TaxId: 469008]} atnlrgvmaalltpfdqqqaldkaslrrlvqfniqqgidglyvggstgeafvqslsereq vleivaeeakgkikliahvgcvstaesqqlaasakrygfdavsavtpfyypfsfeehcdh yraiidsadglpmvvynipalsgvkltldqintlvtlpgvgalkqtsgdlyqmeqirreh pdlvlyngydeifasgllagadggigstynimgwryqgivkalkegdiqtaqklqtecnk vidlliktgvfrglktvlhymdvvsvplcrkpfgpvdekylpelkalaqqlmqe
Timeline for d2wo5d_:
![]() Domains from other chains: (mouse over for more information) d2wo5a1, d2wo5a2, d2wo5b_, d2wo5c_ |