SCOPe 2.01: Domain d2wo4a_: 2wo4 A:

Lineage for d2wo4a_ (2wo4 A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (10 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.2: Carbohydrate-binding domain [49384] (4 families)

5. Family b.2.2.0: automated matches [191610] (1 protein)
   not a true family

6. Protein automated matches [191113] (3 species)
   not a true protein

7. Species Clostridium thermocellum [TaxId:1515] [189176] (3 PDB entries)

8. Domain d2wo4a_: 2wo4 A: [169504]
   automated match to d1g43a_
   complexed with ca, cl, so4

Details for d2wo4a_

PDB Entry: 2wo4, 1.85 Å

PDB Description: 3b' carbohydrate-binding module from the Cel9V glycoside hydrolase from Clostridium thermocellum, in-house data

PDB Compounds: (A:) glycoside hydrolase, family 9

SCOPe Domain Sequences for d2wo4a_:

Sequence; same for both SEQRES and ATOM records:

>d2wo4a_ b.2.2.0 (A:) automated matches {Clostridium thermocellum [TaxId: 1515]}
sqtpdanasisvsykcgvkdgtkntiratinikntgttpvnlsdikvrywftsdgneqnn
fvcdyaafgtdkvkgivkkiensvpgadtyceisftedagrlapggstgtipfriegaae
ydqtddysynsemsddfgdntkitayikdklkygveaaa

Timeline for d2wo4a_:

• d2wo4a_ is new in SCOPe 2.01-stable
  
• d2wo4a_ appears in SCOPe 2.02
  
• d2wo4a_ appears in the current release, SCOPe 2.08, called d2wo4a1