SCOPe 2.03: Domain d2wo3b_: 2wo3 B:

Lineage for d2wo3b_ (2wo3 B:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.5: Ephrin ectodomain [74874] (3 proteins)
   eukaryotic signaling domain probably related to cupredoxins but lacking the metal-binding site
   automatically mapped to Pfam PF00812

6. Protein automated matches [190316] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187131] (3 PDB entries)

8. Domain d2wo3b_: 2wo3 B: [169503]
   Other proteins in same PDB: d2wo3a_
   automated match to d1shwa_

Details for d2wo3b_

PDB Entry: 2wo3, 2.35 Å

PDB Description: crystal structure of the epha4-ephrina2 complex

PDB Compounds: (B:) ephrin-a2

SCOPe Domain Sequences for d2wo3b_:

Sequence; same for both SEQRES and ATOM records:

>d2wo3b_ b.6.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsdryavywnrsnprfhagagddgggytvevsindyldiycphygaplppaermehyvly
mvngeghascdhrqrgfkrwecnrpaapggplkfsekfqlftpfslgfefrpgheyyyis
atppnavdrpclrlkvyvrptq

Timeline for d2wo3b_:

• d2wo3b_ first appeared in SCOPe 2.01
  
• d2wo3b_ appears in SCOPe 2.02
  
• d2wo3b_ appears in SCOPe 2.04
  
• d2wo3b_ appears in the current release, SCOPe 2.08