Lineage for d2wo3b_ (2wo3 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2772145Family b.6.1.5: Ephrin ectodomain [74874] (3 proteins)
    eukaryotic signaling domain probably related to cupredoxins but lacking the metal-binding site
    automatically mapped to Pfam PF00812
  6. 2772167Protein automated matches [190316] (1 species)
    not a true protein
  7. 2772168Species Human (Homo sapiens) [TaxId:9606] [187131] (6 PDB entries)
  8. 2772171Domain d2wo3b_: 2wo3 B: [169503]
    Other proteins in same PDB: d2wo3a1, d2wo3a2, d2wo3a3
    automated match to d1shwa_

Details for d2wo3b_

PDB Entry: 2wo3 (more details), 2.35 Å

PDB Description: crystal structure of the epha4-ephrina2 complex
PDB Compounds: (B:) ephrin-a2

SCOPe Domain Sequences for d2wo3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wo3b_ b.6.1.5 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsdryavywnrsnprfhagagddgggytvevsindyldiycphygaplppaermehyvly
mvngeghascdhrqrgfkrwecnrpaapggplkfsekfqlftpfslgfefrpgheyyyis
atppnavdrpclrlkvyvrptq

SCOPe Domain Coordinates for d2wo3b_:

Click to download the PDB-style file with coordinates for d2wo3b_.
(The format of our PDB-style files is described here.)

Timeline for d2wo3b_: