Lineage for d2wo3a_ (2wo3 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 942101Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 942102Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 942170Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins)
  6. 942184Protein automated matches [190969] (1 species)
    not a true protein
  7. 942185Species Human (Homo sapiens) [TaxId:9606] [188606] (6 PDB entries)
  8. 942188Domain d2wo3a_: 2wo3 A: [169502]
    Other proteins in same PDB: d2wo3b_
    automated match to d1kgya_

Details for d2wo3a_

PDB Entry: 2wo3 (more details), 2.35 Å

PDB Description: crystal structure of the epha4-ephrina2 complex
PDB Compounds: (A:) ephrin type-a receptor

SCOPe Domain Sequences for d2wo3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wo3a_ b.18.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tgevtlldsrsvqgelgwiaspleggweevsimdekntpirtyqvcnvmepsqnnwlrtd
witregaqrvyieikftlrdcnslpgvmgtcketfnlyyyesdndkerfirenqfvkidt
iaadesftqvdigdrimklnteirdvgplskkgfylafqdvgacialvsvrvfykr

SCOPe Domain Coordinates for d2wo3a_:

Click to download the PDB-style file with coordinates for d2wo3a_.
(The format of our PDB-style files is described here.)

Timeline for d2wo3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2wo3b_