SCOPe 2.03: Domain d2wo2a_: 2wo2 A:

Lineage for d2wo2a_ (2wo2 A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families)

5. Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins)
   automatically mapped to Pfam PF01404

6. Protein automated matches [190969] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188606] (8 PDB entries)

8. Domain d2wo2a_: 2wo2 A: [169500]
   Other proteins in same PDB: d2wo2b_
   automated match to d1kgya_
   complexed with nag

Details for d2wo2a_

PDB Entry: 2wo2, 2.45 Å

PDB Description: crystal structure of the epha4-ephrinb2 complex

PDB Compounds: (A:) ephrin type-a receptor

SCOPe Domain Sequences for d2wo2a_:

Sequence; same for both SEQRES and ATOM records:

>d2wo2a_ b.18.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tgevtlldsrsvqgelgwiaspleggweevsimdekntpirtyqvcnvmepsqnnwlrtd
witregaqrvyieikftlrdcnslpgvmgtcketfnlyyyesdndkerfirenqfvkidt
iaadesftqvdigdrimklnteirdvgplskkgfylafqdvgacialvsvrvfykrtk

Timeline for d2wo2a_:

• d2wo2a_ first appeared in SCOPe 2.01
  
• d2wo2a_ appears in SCOPe 2.02
  
• d2wo2a_ appears in SCOPe 2.04
  
• d2wo2a_ appears in the current release, SCOPe 2.08, called d2wo2a1