SCOPe 2.06: Domain d2wo1b1: 2wo1 B:30-202

Lineage for d2wo1b1 (2wo1 B:30-202)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins)
   automatically mapped to Pfam PF01404

6. Protein automated matches [190969] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188606] (10 PDB entries)

8. Domain d2wo1b1: 2wo1 B:30-202 [169499]
   Other proteins in same PDB: d2wo1a2, d2wo1a3, d2wo1b2, d2wo1b3
   automated match to d1kgya_
   complexed with pol

Details for d2wo1b1

PDB Entry: 2wo1, 1.85 Å

PDB Description: crystal structure of the epha4 ligand binding domain

PDB Compounds: (B:) ephrin type-a receptor

SCOPe Domain Sequences for d2wo1b1:

Sequence; same for both SEQRES and ATOM records:

>d2wo1b1 b.18.1.4 (B:30-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evtlldsrsvqgelgwiaspleggweevsimdekntpirtyqvcnvmepsqnnwlrtdwi
tregaqrvyieikftlrdcnslpgvmgtcketfnlyyyesdndkerfirenqfvkidtia
adesftqvdigdrimklnteirdvgplskkgfylafqdvgacialvsvrvfyk

Timeline for d2wo1b1:

• d2wo1b1 first appeared in SCOPe 2.01, called d2wo1b_
  
• d2wo1b1 was called d2wo1b_ in SCOPe 2.05
  
• d2wo1b1 appears in SCOPe 2.07
  
• d2wo1b1 appears in the current release, SCOPe 2.08