Lineage for d2wo1b1 (2wo1 B:30-202)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774192Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins)
    automatically mapped to Pfam PF01404
  6. 2774206Protein automated matches [190969] (1 species)
    not a true protein
  7. 2774207Species Human (Homo sapiens) [TaxId:9606] [188606] (10 PDB entries)
  8. 2774212Domain d2wo1b1: 2wo1 B:30-202 [169499]
    Other proteins in same PDB: d2wo1a2, d2wo1a3, d2wo1b2, d2wo1b3
    automated match to d1kgya_
    complexed with pol

Details for d2wo1b1

PDB Entry: 2wo1 (more details), 1.85 Å

PDB Description: crystal structure of the epha4 ligand binding domain
PDB Compounds: (B:) ephrin type-a receptor

SCOPe Domain Sequences for d2wo1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wo1b1 b.18.1.4 (B:30-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evtlldsrsvqgelgwiaspleggweevsimdekntpirtyqvcnvmepsqnnwlrtdwi
tregaqrvyieikftlrdcnslpgvmgtcketfnlyyyesdndkerfirenqfvkidtia
adesftqvdigdrimklnteirdvgplskkgfylafqdvgacialvsvrvfyk

SCOPe Domain Coordinates for d2wo1b1:

Click to download the PDB-style file with coordinates for d2wo1b1.
(The format of our PDB-style files is described here.)

Timeline for d2wo1b1: