Lineage for d2wo1a_ (2wo1 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1530204Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1530205Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) (S)
  5. 1530274Family b.18.1.4: Ephrin receptor ligand binding domain [49800] (3 proteins)
    automatically mapped to Pfam PF01404
  6. 1530288Protein automated matches [190969] (1 species)
    not a true protein
  7. 1530289Species Human (Homo sapiens) [TaxId:9606] [188606] (10 PDB entries)
  8. 1530290Domain d2wo1a_: 2wo1 A: [169498]
    automated match to d1kgya_
    complexed with pol

Details for d2wo1a_

PDB Entry: 2wo1 (more details), 1.85 Å

PDB Description: crystal structure of the epha4 ligand binding domain
PDB Compounds: (A:) ephrin type-a receptor

SCOPe Domain Sequences for d2wo1a_:

Sequence, based on SEQRES records: (download)

>d2wo1a_ b.18.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etgevtlldsrsvqgelgwiaspleggweevsimdekntpirtyqvcnvmepsqnnwlrt
dwitregaqrvyieikftlrdcnslpgvmgtcketfnlyyyesdndkerfirenqfvkid
tiaadesftqvdigdrimklnteirdvgplskkgfylafqdvgacialvsvrvfykrtkh
hhh

Sequence, based on observed residues (ATOM records): (download)

>d2wo1a_ b.18.1.4 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
etgevtlldsrsvqgelgwiaspleggweevsimdkntpirtyqvcnvmepsqnnwlrtd
witregaqrvyieikftlrdcnslpgvmgtcketfnlyyyesdndkerfirenqfvkidt
iaadesftqvddrimklnteirdvgplskkgfylafqdvgacialvsvrvfykrtkhhhh

SCOPe Domain Coordinates for d2wo1a_:

Click to download the PDB-style file with coordinates for d2wo1a_.
(The format of our PDB-style files is described here.)

Timeline for d2wo1a_: