SCOPe 2.08: Domain d2wnyb_: 2wny B:

Lineage for d2wnyb_ (2wny B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.77: RL5-like [55281] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta(3)-alpha; 2 layers, alpha/beta; antiparallel beta-sheet: order 231654

4. Superfamily d.77.1: RL5-like [55282] (3 families)

5. Family d.77.1.0: automated matches [191541] (1 protein)
   not a true family

6. Protein automated matches [190927] (3 species)
   not a true protein

7. Species Methanothermobacter thermautotrophicus [TaxId:145262] [189458] (1 PDB entry)

8. Domain d2wnyb_: 2wny B: [169496]
   automated match to d2ogka1
   complexed with cl, ni

Details for d2wnyb_

PDB Entry: 2wny, 1.95 Å

PDB Description: structure of mth689, a duf54 protein from methanothermobacter thermautotrophicus

PDB Compounds: (B:) conserved protein mth689

SCOPe Domain Sequences for d2wnyb_:

Sequence; same for both SEQRES and ATOM records:

>d2wnyb_ d.77.1.0 (B:) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]}
dmihnisyclmvygtedeekviealrnvipgatperesaegyhgnpitvlrgrldrrral
refmekftevfrgrmdeledrfdengnlflrldkqkalegvwepvrhgdaihlkikveay
pakrevavenirkile

Timeline for d2wnyb_:

• d2wnyb_ first appeared in SCOPe 2.01
  
• d2wnyb_ appears in SCOPe 2.07