Lineage for d2wnvf_ (2wnv F:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532068Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1532069Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 1532070Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 1532134Protein Complement c1q globular head, C chain [101617] (1 species)
    hetrotrimer of A, B and C chains
  7. 1532135Species Human (Homo sapiens) [TaxId:9606] [101618] (5 PDB entries)
  8. 1532137Domain d2wnvf_: 2wnv F: [169493]
    Other proteins in same PDB: d2wnva_, d2wnvb_, d2wnvd_, d2wnve_
    automated match to d1pk6c_
    complexed with 2dr, ca, nag

Details for d2wnvf_

PDB Entry: 2wnv (more details), 1.25 Å

PDB Description: complex between c1q globular heads and deoxyribose
PDB Compounds: (F:) complement c1q subcomponent subunit c

SCOPe Domain Sequences for d2wnvf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wnvf_ b.22.1.1 (F:) Complement c1q globular head, C chain {Human (Homo sapiens) [TaxId: 9606]}
kfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftckvpglyyfvyhashta
nlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwlavndyydmvgiqgsdsv
fsgfllfpd

SCOPe Domain Coordinates for d2wnvf_:

Click to download the PDB-style file with coordinates for d2wnvf_.
(The format of our PDB-style files is described here.)

Timeline for d2wnvf_: