SCOPe 2.06: Domain d2wnve_: 2wnv E:

Lineage for d2wnve_ (2wnv E:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.1: TNF-like [49843] (15 proteins)

6. Protein automated matches [190204] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186956] (11 PDB entries)

8. Domain d2wnve_: 2wnv E: [169492]
   Other proteins in same PDB: d2wnva_, d2wnvc_, d2wnvd_, d2wnvf_
   automated match to d1pk6b_
   complexed with 2dr, ca, nag

Details for d2wnve_

PDB Entry: 2wnv, 1.25 Å

PDB Description: complex between c1q globular heads and deoxyribose

PDB Compounds: (E:) complement c1q subcomponent subunit b

SCOPe Domain Sequences for d2wnve_:

Sequence, based on SEQRES records:

>d2wnve_ b.22.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrgn
lcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmegan
sifsgfllfpdm

Sequence, based on observed residues (ATOM records):

>d2wnve_ b.22.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qkiafsatrtiplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrgnlc
vnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmegansi
fsgfllfpdm

Timeline for d2wnve_:

• d2wnve_ first appeared in SCOPe 2.01
  
• d2wnve_ appears in SCOPe 2.05
  
• d2wnve_ appears in SCOPe 2.07
  
• d2wnve_ appears in the current release, SCOPe 2.08