![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
![]() | Family b.22.1.1: TNF-like [49843] (15 proteins) |
![]() | Protein Complement c1q globular head, C chain [101617] (1 species) hetrotrimer of A, B and C chains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101618] (5 PDB entries) |
![]() | Domain d2wnvc_: 2wnv C: [169491] Other proteins in same PDB: d2wnvb_, d2wnve_ automated match to d1pk6c_ complexed with 2dr, ca, nag |
PDB Entry: 2wnv (more details), 1.25 Å
SCOPe Domain Sequences for d2wnvc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wnvc_ b.22.1.1 (C:) Complement c1q globular head, C chain {Human (Homo sapiens) [TaxId: 9606]} kfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftckvpglyyfvyhashta nlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwlavndyydmvgiqgsdsv fsgfllfpd
Timeline for d2wnvc_: