Lineage for d2eiaa1 (2eia A:148-222)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1487377Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1487597Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 1487598Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)
  6. 1487599Protein EIAV capsid protein p26 [47355] (1 species)
  7. 1487600Species Equine infectious anemia virus [TaxId:11665] [47356] (2 PDB entries)
  8. 1487601Domain d2eiaa1: 2eia A:148-222 [16949]
    Other proteins in same PDB: d2eiaa2, d2eiab2

Details for d2eiaa1

PDB Entry: 2eia (more details), 2.7 Å

PDB Description: x-ray crystal structure of equine infectious anemia virus (eiav) capsid protein p26
PDB Compounds: (A:) eiav capsid protein p26

SCOPe Domain Sequences for d2eiaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eiaa1 a.28.3.1 (A:148-222) EIAV capsid protein p26 {Equine infectious anemia virus [TaxId: 11665]}
pkaqnirqgakepypefvdrllsqikseghpqeiskfltdtltiqnaneecrnamrhlrp
edtleekmyacrdig

SCOPe Domain Coordinates for d2eiaa1:

Click to download the PDB-style file with coordinates for d2eiaa1.
(The format of our PDB-style files is described here.)

Timeline for d2eiaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2eiaa2