| Class b: All beta proteins [48724] (176 folds) |
| Fold b.22: TNF-like [49841] (1 superfamily) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.22.1: TNF-like [49842] (2 families) ![]() |
| Family b.22.1.1: TNF-like [49843] (15 proteins) |
| Protein Complement c1q globular head, C chain [101617] (1 species) hetrotrimer of A, B and C chains |
| Species Human (Homo sapiens) [TaxId:9606] [101618] (5 PDB entries) |
| Domain d2wnuf_: 2wnu F: [169489] Other proteins in same PDB: d2wnua_, d2wnub_, d2wnud_, d2wnue_ automated match to d1pk6c_ complexed with nag |
PDB Entry: 2wnu (more details), 2.3 Å
SCOPe Domain Sequences for d2wnuf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wnuf_ b.22.1.1 (F:) Complement c1q globular head, C chain {Human (Homo sapiens) [TaxId: 9606]}
kfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftckvpglyyfvyhashta
nlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwlavndyydmvgiqgsdsv
fsgfllfpd
Timeline for d2wnuf_: