Lineage for d2wnuf_ (2wnu F:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2372079Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2372080Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 2372081Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 2372145Protein Complement c1q globular head, C chain [101617] (1 species)
    hetrotrimer of A, B and C chains
  7. 2372146Species Human (Homo sapiens) [TaxId:9606] [101618] (5 PDB entries)
  8. 2372155Domain d2wnuf_: 2wnu F: [169489]
    Other proteins in same PDB: d2wnua_, d2wnub_, d2wnud_, d2wnue_
    automated match to d1pk6c_
    complexed with nag

Details for d2wnuf_

PDB Entry: 2wnu (more details), 2.3 Å

PDB Description: complex between c1q globular heads and heparan sulfate
PDB Compounds: (F:) complement c1q subcomponent subunit c

SCOPe Domain Sequences for d2wnuf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wnuf_ b.22.1.1 (F:) Complement c1q globular head, C chain {Human (Homo sapiens) [TaxId: 9606]}
kfqsvftvtrqthqppapnslirfnavltnpqgdydtstgkftckvpglyyfvyhashta
nlcvllyrsgvkvvtfcghtsktnqvnsggvllrlqvgeevwlavndyydmvgiqgsdsv
fsgfllfpd

SCOPe Domain Coordinates for d2wnuf_:

Click to download the PDB-style file with coordinates for d2wnuf_.
(The format of our PDB-style files is described here.)

Timeline for d2wnuf_: