SCOPe 2.02: Domain d2wnue_: 2wnu E:

Lineage for d2wnue_ (2wnu E:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.1: TNF-like [49843] (15 proteins)

6. Protein automated matches [190204] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186956] (8 PDB entries)

8. Domain d2wnue_: 2wnu E: [169488]
   Other proteins in same PDB: d2wnua_, d2wnuc_, d2wnud_, d2wnuf_
   automated match to d1pk6b_
   complexed with nag

Details for d2wnue_

PDB Entry: 2wnu, 2.3 Å

PDB Description: complex between c1q globular heads and heparan sulfate

PDB Compounds: (E:) complement c1q subcomponent subunit b

SCOPe Domain Sequences for d2wnue_:

Sequence; same for both SEQRES and ATOM records:

>d2wnue_ b.22.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrg
nlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmega
nsifsgfllfpdm

Timeline for d2wnue_:

• d2wnue_ first appeared in SCOPe 2.01
  
• d2wnue_ appears in SCOPe 2.03
  
• d2wnue_ appears in the current release, SCOPe 2.08