Lineage for d2wnue_ (2wnu E:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1117451Fold b.22: TNF-like [49841] (1 superfamily)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 1117452Superfamily b.22.1: TNF-like [49842] (2 families) (S)
  5. 1117453Family b.22.1.1: TNF-like [49843] (15 proteins)
  6. 1117692Protein automated matches [190204] (3 species)
    not a true protein
  7. 1117693Species Human (Homo sapiens) [TaxId:9606] [186956] (8 PDB entries)
  8. 1117700Domain d2wnue_: 2wnu E: [169488]
    Other proteins in same PDB: d2wnua_, d2wnuc_, d2wnud_, d2wnuf_
    automated match to d1pk6b_
    complexed with nag

Details for d2wnue_

PDB Entry: 2wnu (more details), 2.3 Å

PDB Description: complex between c1q globular heads and heparan sulfate
PDB Compounds: (E:) complement c1q subcomponent subunit b

SCOPe Domain Sequences for d2wnue_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wnue_ b.22.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tqkiafsatrtinvplrrdqtirfdhvitnmnnnyeprsgkftckvpglyyftyhassrg
nlcvnlmrgreraqkvvtfcdyayntfqvttggmvlkleqgenvflqatdknsllgmega
nsifsgfllfpdm

SCOPe Domain Coordinates for d2wnue_:

Click to download the PDB-style file with coordinates for d2wnue_.
(The format of our PDB-style files is described here.)

Timeline for d2wnue_: