SCOPe 2.01: Domain d2wnda_: 2wnd A:

Lineage for d2wnda_ (2wnd A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.2: S100 proteins [47478] (2 proteins)
   dimer: subunits are made of two EF-hands

6. Protein automated matches [190132] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187203] (16 PDB entries)

8. Domain d2wnda_: 2wnd A: [169476]
   automated match to d1psra_
   complexed with ca, zn; mutant

Details for d2wnda_

PDB Entry: 2wnd, 1.6 Å

PDB Description: structure of an s100a7 triple mutant

PDB Compounds: (A:) protein s100-a7

SCOPe Domain Sequences for d2wnda_:

Sequence; same for both SEQRES and ATOM records:

>d2wnda_ a.39.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sntqaersiigmidmfhkytrrddkidkpslltmmkenfpnflsacdkkgtnylagvfek
kdknedkkidfseflslmgdiatdyhkkshgaapcs

Timeline for d2wnda_:

• d2wnda_ is new in SCOPe 2.01-stable
  
• d2wnda_ appears in SCOPe 2.02
  
• d2wnda_ appears in the current release, SCOPe 2.08