Lineage for d2wmzc_ (2wmz C:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3022539Fold f.5: Outer membrane efflux proteins (OEP) [56953] (1 superfamily)
    subunit fold contains tandem repeat of alpha-beta hairpin-alpha(2) motif
    trimeric fold contains barrel (n=12, S=18) formed by beta-hairpins, two from each subunit, and a bundle of helices with a channel running through it
  4. 3022540Superfamily f.5.1: Outer membrane efflux proteins (OEP) [56954] (2 families) (S)
  5. 3022541Family f.5.1.1: Outer membrane efflux proteins (OEP) [56955] (3 proteins)
    Pfam PF02321
  6. 3022557Protein automated matches [191223] (3 species)
    not a true protein
  7. 3022558Species Escherichia coli K-12 [TaxId:83333] [189623] (2 PDB entries)
  8. 3022561Domain d2wmzc_: 2wmz C: [169475]
    automated match to d1ek9a_
    complexed with cl, na, pge

Details for d2wmzc_

PDB Entry: 2wmz (more details), 2.9 Å

PDB Description: structure of a mutated tolc
PDB Compounds: (C:) outer membrane protein tolc

SCOPe Domain Sequences for d2wmzc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wmzc_ f.5.1.1 (C:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
enlmqvyqqarlsnpelrksaadrdaafekinearspllpqlglgadytysngyrdangi
nsnatsaslqltqsifdmskwraltlqekaagiqdvtyqtdqqtlilntatayfnvlnai
dvlsytqaqkeaiyrqldqttqrfnvglvaitdvqnaraqydtvlaneltarnnldnave
qlrqitgnyypelaalnvenfktdkpqpvnallkeaekrnlsllqarlsqdlareqirqa
qdghlptldltastgisdtsysgsktrgaagtqyddsnmgqnkvglsfslpiyqggmvns
qvkqaqynfvgaseqlesahrsvvqtvrssfnninasissinaykqavvsaqssldamea
gysvgtstivdvldatttlynakqelanarynylinqlniksalgtlneqdllalnnals
kpvstnpe

SCOPe Domain Coordinates for d2wmzc_:

Click to download the PDB-style file with coordinates for d2wmzc_.
(The format of our PDB-style files is described here.)

Timeline for d2wmzc_: