Lineage for d2wmyf_ (2wmy F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874827Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2874828Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2874901Family c.44.1.0: automated matches [191415] (1 protein)
    not a true family
  6. 2874902Protein automated matches [190574] (20 species)
    not a true protein
  7. 2874928Species Escherichia coli [TaxId:562] [189034] (2 PDB entries)
  8. 2874934Domain d2wmyf_: 2wmy F: [169470]
    automated match to d1bvha_
    complexed with ni, so4

Details for d2wmyf_

PDB Entry: 2wmy (more details), 2.21 Å

PDB Description: crystal structure of the tyrosine phosphatase wzb from escherichia coli k30 in complex with sulphate.
PDB Compounds: (F:) putative acid phosphatase wzb

SCOPe Domain Sequences for d2wmyf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wmyf_ c.44.1.0 (F:) automated matches {Escherichia coli [TaxId: 562]}
mfdsilvictgnicrspigerllrrllpskkinsagvgalvdhtadesairvaeknglcl
kghrgtkftsalarqydlllvmeyshleqisriapeargktmlfghwldskeipdpyrms
deafdsvyqlleqaskrwaeklge

SCOPe Domain Coordinates for d2wmyf_:

Click to download the PDB-style file with coordinates for d2wmyf_.
(The format of our PDB-style files is described here.)

Timeline for d2wmyf_: