![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.86: eIF4e-like [55417] (1 superfamily) beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478 |
![]() | Superfamily d.86.1: eIF4e-like [55418] (3 families) ![]() |
![]() | Family d.86.1.0: automated matches [191459] (1 protein) not a true family |
![]() | Protein automated matches [190708] (5 species) not a true protein |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [189457] (1 PDB entry) |
![]() | Domain d2wmce_: 2wmc E: [169451] automated match to d2v8we1 complexed with mgp |
PDB Entry: 2wmc (more details), 2.2 Å
SCOPe Domain Sequences for d2wmce_:
Sequence, based on SEQRES records: (download)
>d2wmce_ d.86.1.0 (E:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} phllenswtfwfdtpaakskqaawgssmrpiytfstveefwsiynnihhpgklavgadfy cfkhkiepkwedpicanggkwtanypkgksdtswlytllamigeqfdhgdeicgavvnvr graekisiwtknasneaaqvsigkqwkefldynetmgfifhddarkldrnaknkyvv
>d2wmce_ d.86.1.0 (E:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} phllenswtfwfdtpaawgssmrpiytfstveefwsiynnihhpgklavgadfycfkhki epkwedpicanggkwtanypkgksdtswlytllamigeqfdhgdeicgavvnvrgraeki siwtknasneaaqvsigkqwkefldynetmgfifhddarkaknkyvv
Timeline for d2wmce_: