Lineage for d2wmcc_ (2wmc C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962641Fold d.86: eIF4e-like [55417] (1 superfamily)
    beta(2)-alpha-beta(2)-alpha-beta(2)-alpha-beta-2; 2 layers: alpha/beta; antiparallel sheet: 21356478
  4. 2962642Superfamily d.86.1: eIF4e-like [55418] (3 families) (S)
  5. 2962762Family d.86.1.0: automated matches [191459] (1 protein)
    not a true family
  6. 2962763Protein automated matches [190708] (10 species)
    not a true protein
  7. 2962819Species Pea (Pisum sativum) [TaxId:3888] [189457] (1 PDB entry)
  8. 2962822Domain d2wmcc_: 2wmc C: [169449]
    automated match to d2v8we1
    complexed with mgp

Details for d2wmcc_

PDB Entry: 2wmc (more details), 2.2 Å

PDB Description: crystal structure of eukaryotic initiation factor 4e from pisum sativum
PDB Compounds: (C:) eukaryotic translation initiation factor 4e

SCOPe Domain Sequences for d2wmcc_:

Sequence, based on SEQRES records: (download)

>d2wmcc_ d.86.1.0 (C:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
phllenswtfwfdtpaakskqaawgssmrpiytfstveefwsiynnihhpgklavgadfy
cfkhkiepkwedpicanggkwtanypkgksdtswlytllamigeqfdhgdeicgavvnvr
graekisiwtknasneaaqvsigkqwkefldynetmgfifhddarkldrnaknkyvv

Sequence, based on observed residues (ATOM records): (download)

>d2wmcc_ d.86.1.0 (C:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
phllenswtfwfdtpaakskaawgssmrpiytfstveefwsiynnihhpgklavgadfyc
fkhkiepkwedpicanggkwtanypkgksdtswlytllamigeqfdhgdeicgavvnvrg
raekisiwtknasneaaqvsigkqwkefldynetmgfifhddarnaknkyvv

SCOPe Domain Coordinates for d2wmcc_:

Click to download the PDB-style file with coordinates for d2wmcc_.
(The format of our PDB-style files is described here.)

Timeline for d2wmcc_: