SCOPe 2.04: Domain d2wmaa_: 2wma A:

Lineage for d2wmaa_ (2wma A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [88856] (340 PDB entries)
   Uniprot P24941

8. Domain d2wmaa_: 2wma A: [169443]
   automated match to d1vywa_

Details for d2wmaa_

PDB Entry: 2wma, 2.8 Å

PDB Description: structural and thermodynamic consequences of cyclization of peptide ligands for the recruitment site of cyclin a

PDB Compounds: (A:) Cell division protein kinase 2

SCOPe Domain Sequences for d2wmaa_:

Sequence; same for both SEQRES and ATOM records:

>d2wmaa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl

Timeline for d2wmaa_:

• d2wmaa_ first appeared in SCOPe 2.01
  
• d2wmaa_ appears in SCOPe 2.03
  
• d2wmaa_ appears in SCOPe 2.05
  
• d2wmaa_ appears in the current release, SCOPe 2.08, called d2wmaa1