![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family) ![]() |
![]() | Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins) |
![]() | Protein ImmE9 protein (Im9) [47351] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [47352] (17 PDB entries) |
![]() | Domain d1emva_: 1emv A: [16944] Other proteins in same PDB: d1emvb_ protein/DNA complex; complexed with po4 |
PDB Entry: 1emv (more details), 1.7 Å
SCOPe Domain Sequences for d1emva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1emva_ a.28.2.1 (A:) ImmE9 protein (Im9) {Escherichia coli [TaxId: 562]} lkhsisdyteaeflqlvtticnadtsseeelvklvthfeemtehpsgsdliyypkegddd spsgivntvkqwraangksgfkq
Timeline for d1emva_: