Lineage for d2wlpb_ (2wlp B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 966111Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 966284Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 966691Family b.121.4.7: Tombusviridae-like VP [88643] (5 protein domains)
  6. 966730Protein automated matches [190821] (2 species)
    not a true protein
  7. 966731Species Sesbania grandiflora [TaxId:206309] [189033] (1 PDB entry)
  8. 966733Domain d2wlpb_: 2wlp B: [169434]
    automated match to d1vaka_
    mutant

Details for d2wlpb_

PDB Entry: 2wlp (more details), 2.65 Å

PDB Description: sesbania mosaic virus capsid protein dimer mutant (rcp-del-n65-w170k)
PDB Compounds: (B:) coat protein

SCOPe Domain Sequences for d2wlpb_:

Sequence, based on SEQRES records: (download)

>d2wlpb_ b.121.4.7 (B:) automated matches {Sesbania grandiflora [TaxId: 206309]}
gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
sstagsihmgfqydmadtvpvsvnqlsnlrgyvsgqvksgsaglcfingtrcsdtstais
ttldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyc
tytiqmieptas

Sequence, based on observed residues (ATOM records): (download)

>d2wlpb_ b.121.4.7 (B:) automated matches {Sesbania grandiflora [TaxId: 206309]}
gitvlthselsaeigvtdsivvsselvmpytvgtwlrgvaanwskyswlsvrytyipscp
sstgsihmgfqydmadtvpvsvnqlsnlrgyvsgqvksgsaglcfingtrcsdtstaist
tldvsklgkkwypyktsadyatavgvdvniatplvparlvialldgssstavaagriyct
ytiqmieptas

SCOPe Domain Coordinates for d2wlpb_:

Click to download the PDB-style file with coordinates for d2wlpb_.
(The format of our PDB-style files is described here.)

Timeline for d2wlpb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2wlpa_