Class b: All beta proteins [48724] (174 folds) |
Fold b.50: Acid proteases [50629] (1 superfamily) barrel, closed; n=6, S=10, complex topology |
Superfamily b.50.1: Acid proteases [50630] (4 families) |
Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins) dimer of identical mono-domain chains, each containing (6,10) barrel |
Protein Human immunodeficiency virus type 1 protease [50632] (8 species) |
Species Human immunodeficiency virus type 1 (isolate z2/cdc-z34 group m subtype d) [TaxId:11683] [189173] (1 PDB entry) |
Domain d2wkza_: 2wkz A: [169425] automated match to d1ajva_ complexed with 5ah |
PDB Entry: 2wkz (more details), 1.7 Å
SCOPe Domain Sequences for d2wkza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wkza_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 (isolate z2/cdc-z34 group m subtype d) [TaxId: 11683]} pqitlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd qilieicghkaigtvlvgptpvniigrnlltqigctlnf
Timeline for d2wkza_: