SCOPe 2.03: Domain d2wkxa1: 2wkx A:180-261

Lineage for d2wkxa1 (2wkx A:180-261)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.20: PGBD-like [47089] (1 superfamily)
   core: 3 helices; bundle, closed, left-handed twist; parallel

4. Superfamily a.20.1: PGBD-like [47090] (2 families)

5. Family a.20.1.1: Peptidoglycan binding domain, PGBD [47091] (2 proteins)

6. Protein Probable N-acetylmuramoyl-L-alanine amidase YbjR, C-terminal domain [140390] (1 species)

7. Species Escherichia coli [TaxId:562] [140391] (2 PDB entries)
   Uniprot P75820 195-275

8. Domain d2wkxa1: 2wkx A:180-261 [169423]
   Other proteins in same PDB: d2wkxa2
   complexed with cl, gol, zn

Details for d2wkxa1

PDB Entry: 2wkx, 1.8 Å

PDB Description: crystal structure of the native e. coli zinc amidase amid

PDB Compounds: (A:) n-acetylmuramoyl-l-alanine amidase amid

SCOPe Domain Sequences for d2wkxa1:

Sequence; same for both SEQRES and ATOM records:

>d2wkxa1 a.20.1.1 (A:180-261) Probable N-acetylmuramoyl-L-alanine amidase YbjR, C-terminal domain {Escherichia coli [TaxId: 562]}
pdaqrvnfylagraphtpvdtasllellarygydvkpdmtpreqrrvimafqmhfrptly
ngeadaetqaiaeallekygqd

Timeline for d2wkxa1:

• d2wkxa1 first appeared in SCOPe 2.01
  
• d2wkxa1 appears in SCOPe 2.02
  
• d2wkxa1 appears in SCOPe 2.04
  
• d2wkxa1 appears in the current release, SCOPe 2.08