Lineage for d2wkxa1 (2wkx A:180-261)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1082515Fold a.20: PGBD-like [47089] (1 superfamily)
    core: 3 helices; bundle, closed, left-handed twist; parallel
  4. 1082516Superfamily a.20.1: PGBD-like [47090] (2 families) (S)
  5. 1082517Family a.20.1.1: Peptidoglycan binding domain, PGBD [47091] (2 proteins)
  6. 1082518Protein Probable N-acetylmuramoyl-L-alanine amidase YbjR, C-terminal domain [140390] (1 species)
  7. 1082519Species Escherichia coli [TaxId:562] [140391] (2 PDB entries)
    Uniprot P75820 195-275
  8. 1082520Domain d2wkxa1: 2wkx A:180-261 [169423]
    Other proteins in same PDB: d2wkxa2
    complexed with cl, gol, zn

Details for d2wkxa1

PDB Entry: 2wkx (more details), 1.8 Å

PDB Description: crystal structure of the native e. coli zinc amidase amid
PDB Compounds: (A:) n-acetylmuramoyl-l-alanine amidase amid

SCOPe Domain Sequences for d2wkxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wkxa1 a.20.1.1 (A:180-261) Probable N-acetylmuramoyl-L-alanine amidase YbjR, C-terminal domain {Escherichia coli [TaxId: 562]}
pdaqrvnfylagraphtpvdtasllellarygydvkpdmtpreqrrvimafqmhfrptly
ngeadaetqaiaeallekygqd

SCOPe Domain Coordinates for d2wkxa1:

Click to download the PDB-style file with coordinates for d2wkxa1.
(The format of our PDB-style files is described here.)

Timeline for d2wkxa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2wkxa2