Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) |
Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins) automatically mapped to Pfam PF01220 |
Protein automated matches [190071] (5 species) not a true protein |
Species Helicobacter pylori [TaxId:210] [187015] (7 PDB entries) |
Domain d2wksd_: 2wks D: [169418] automated match to d1j2ya_ complexed with cb6 |
PDB Entry: 2wks (more details), 2.95 Å
SCOPe Domain Sequences for d2wksd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wksd_ c.23.13.1 (D:) automated matches {Helicobacter pylori [TaxId: 210]} mkilviqgpnlnmlghrdprlygmvtldqiheimqtfvkqgnldveleffqtnfegeiid kiqesvgsdyegiiinpgafshtsiaiadaimlagkpvievhltniqareefrknsytga acggvimgfgplgynmalmamvnilaemkafqe
Timeline for d2wksd_: