Lineage for d2wksb_ (2wks B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857821Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2857822Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 2857936Protein automated matches [190071] (6 species)
    not a true protein
  7. 2857980Species Helicobacter pylori [TaxId:210] [187015] (7 PDB entries)
  8. 2857991Domain d2wksb_: 2wks B: [169416]
    automated match to d1j2ya_
    complexed with cb6

Details for d2wksb_

PDB Entry: 2wks (more details), 2.95 Å

PDB Description: structure of helicobacter pylori type ii dehydroquinase with a new carbasugar-thiophene inhibitor.
PDB Compounds: (B:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d2wksb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wksb_ c.23.13.1 (B:) automated matches {Helicobacter pylori [TaxId: 210]}
mkilviqgpnlnmlghrdprlygmvtldqiheimqtfvkqgnldveleffqtnfegeiid
kiqesvgsdyegiiinpgafshtsiaiadaimlagkpvievhltniqareefrknsytga
acggvimgfgplgynmalmamvnilaemkafqe

SCOPe Domain Coordinates for d2wksb_:

Click to download the PDB-style file with coordinates for d2wksb_.
(The format of our PDB-style files is described here.)

Timeline for d2wksb_: