Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
Protein automated matches [190029] (6 species) not a true protein |
Species Inky cap fungus (Coprinopsis cinerea) [TaxId:5346] [189197] (1 PDB entry) |
Domain d2wkkd_: 2wkk D: [169414] automated match to d1ul9a_ complexed with gol, mg |
PDB Entry: 2wkk (more details), 1.5 Å
SCOPe Domain Sequences for d2wkkd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wkkd_ b.29.1.3 (D:) automated matches {Inky cap fungus (Coprinopsis cinerea) [TaxId: 5346]} mlyhlfvnnqvklqndfkpesvaairssafnskggttvfnflsagenillhisirpgenv ivfnsrlkngawgpeeripyaekfrppnpsitvidhgdrfqirfdygtsiyynkrikena aaiaynaenslfsspvtvdvhgllpplppa
Timeline for d2wkkd_: