Lineage for d2wkkd_ (2wkk D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2779190Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins)
  6. 2779456Protein automated matches [190029] (6 species)
    not a true protein
  7. 2779520Species Inky cap fungus (Coprinopsis cinerea) [TaxId:5346] [189197] (1 PDB entry)
  8. 2779524Domain d2wkkd_: 2wkk D: [169414]
    automated match to d1ul9a_
    complexed with gol, mg

Details for d2wkkd_

PDB Entry: 2wkk (more details), 1.5 Å

PDB Description: identification of the glycan target of the nematotoxic fungal galectin cgl2 in caenorhabditis elegans
PDB Compounds: (D:) galectin-2

SCOPe Domain Sequences for d2wkkd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wkkd_ b.29.1.3 (D:) automated matches {Inky cap fungus (Coprinopsis cinerea) [TaxId: 5346]}
mlyhlfvnnqvklqndfkpesvaairssafnskggttvfnflsagenillhisirpgenv
ivfnsrlkngawgpeeripyaekfrppnpsitvidhgdrfqirfdygtsiyynkrikena
aaiaynaenslfsspvtvdvhgllpplppa

SCOPe Domain Coordinates for d2wkkd_:

Click to download the PDB-style file with coordinates for d2wkkd_.
(The format of our PDB-style files is described here.)

Timeline for d2wkkd_: