| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.3: Galectin (animal S-lectin) [49932] (9 proteins) |
| Protein automated matches [190029] (6 species) not a true protein |
| Species Inky cap fungus (Coprinopsis cinerea) [TaxId:5346] [189197] (1 PDB entry) |
| Domain d2wkka_: 2wkk A: [169411] automated match to d1ul9a_ complexed with gol, mg |
PDB Entry: 2wkk (more details), 1.5 Å
SCOPe Domain Sequences for d2wkka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wkka_ b.29.1.3 (A:) automated matches {Inky cap fungus (Coprinopsis cinerea) [TaxId: 5346]}
mlyhlfvnnqvklqndfkpesvaairssafnskggttvfnflsagenillhisirpgenv
ivfnsrlkngawgpeeripyaekfrppnpsitvidhgdrfqirfdygtsiyynkrikena
aaiaynaenslfsspvtvdvhgllpplppa
Timeline for d2wkka_: