Class a: All alpha proteins [46456] (258 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family) |
Family a.28.2.1: Colicin E immunity proteins [47346] (3 proteins) |
Protein ImmE7 protein (Im7) [47347] (1 species) |
Species Escherichia coli [TaxId:562] [47348] (10 PDB entries) |
Domain d7ceia_: 7cei A: [16941] Other proteins in same PDB: d7ceib_ complexed with zn3 |
PDB Entry: 7cei (more details), 2.3 Å
SCOP Domain Sequences for d7ceia_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ceia_ a.28.2.1 (A:) ImmE7 protein (Im7) {Escherichia coli [TaxId: 562]} melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn rddspegivkeikewraangkpgfkqg
Timeline for d7ceia_: