Lineage for d7ceia_ (7cei A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316392Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2316587Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families) (S)
    automatically mapped to Pfam PF01320
  5. 2316588Family a.28.2.1: Colicin E immunity proteins [47346] (4 protein domains)
  6. 2316589Protein ImmE7 protein (Im7) [47347] (1 species)
  7. 2316590Species Escherichia coli [TaxId:562] [47348] (10 PDB entries)
  8. 2316603Domain d7ceia_: 7cei A: [16941]
    Other proteins in same PDB: d7ceib_
    protein/DNA complex; complexed with zn

Details for d7ceia_

PDB Entry: 7cei (more details), 2.3 Å

PDB Description: the endonuclease domain of colicin e7 in complex with its inhibitor im7 protein
PDB Compounds: (A:) protein (colicin e7 immunity protein)

SCOPe Domain Sequences for d7ceia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ceia_ a.28.2.1 (A:) ImmE7 protein (Im7) {Escherichia coli [TaxId: 562]}
melknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdn
rddspegivkeikewraangkpgfkqg

SCOPe Domain Coordinates for d7ceia_:

Click to download the PDB-style file with coordinates for d7ceia_.
(The format of our PDB-style files is described here.)

Timeline for d7ceia_: