Lineage for d2wkha_ (2wkh A:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450062Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 1450418Protein Class D beta-lactamase [56622] (4 species)
  7. 1450432Species Pseudomonas aeruginosa, OXA-10 [TaxId:287] [56623] (25 PDB entries)
  8. 1450463Domain d2wkha_: 2wkh A: [169403]
    automated match to d1k4fb_
    complexed with so4, zz7

Details for d2wkha_

PDB Entry: 2wkh (more details), 1.79 Å

PDB Description: Crystal structure of the acyl-enzyme OXA-10 K70C-Ampicillin at pH 7
PDB Compounds: (A:) beta-lactamase oxa-10

SCOPe Domain Sequences for d2wkha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wkha_ e.3.1.1 (A:) Class D beta-lactamase {Pseudomonas aeruginosa, OXA-10 [TaxId: 287]}
sitentswnkefsaeavngvfvlckssskscatndlaraskeylpastfcipnaiiglet
gviknehqvfkwdgkpramkqwerdltlrgaiqvsavpvfqqiarevgevrmqkylkkfs
ygnqnisggidkfwlegqlrisavnqvefleslylnklsaskenqlivkealvteaapey
lvhsktgfsgvgtesnpgvawwvgwveketevyffafnmdidnesklplrksiptkimes
egii

SCOPe Domain Coordinates for d2wkha_:

Click to download the PDB-style file with coordinates for d2wkha_.
(The format of our PDB-style files is described here.)

Timeline for d2wkha_: