SCOPe 2.08: Domain d2wkfb_: 2wkf B:

Lineage for d2wkfb_ (2wkf B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.0: automated matches [191533] (1 protein)
   not a true family

6. Protein automated matches [190903] (22 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [189094] (1 PDB entry)

8. Domain d2wkfb_: 2wkf B: [169402]
   automated match to d1cgqa_
   complexed with gol

Details for d2wkfb_

PDB Entry: 2wkf, 2.05 Å

PDB Description: crystal structure of macrophage migration inhibitory factor from plasmodium falciparum

PDB Compounds: (B:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d2wkfb_:

Sequence, based on SEQRES records:

>d2wkfb_ d.80.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
pccevitnvnlpddnvqstlsqienaisdvmgkplgyimsnydyqknlrfggsneaycfv
ritsigginrsnnsaladqitkllvsnlnvksrriyvefrdcsaqn

Sequence, based on observed residues (ATOM records):

>d2wkfb_ d.80.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
pccevitnvnlpddnvqstlsqienaisdvmgkgyimsnydyqknlrfggsneaycfvri
tsigginrsnnsaladqitkllvsnlnvksrriyvefrdcsaqn

Timeline for d2wkfb_:

• d2wkfb_ first appeared in SCOPe 2.01
  
• d2wkfb_ appears in SCOPe 2.07