SCOPe 2.08: Domain d2wkbe1: 2wkb E:1-115

Lineage for d2wkbe1 (2wkb E:1-115)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.0: automated matches [191533] (1 protein)
   not a true family

6. Protein automated matches [190903] (22 species)
   not a true protein

7. Species Plasmodium berghei [TaxId:5823] [189095] (1 PDB entry)

8. Domain d2wkbe1: 2wkb E:1-115 [169398]
   Other proteins in same PDB: d2wkba2, d2wkbc2, d2wkbd2, d2wkbe2, d2wkbf2
   automated match to d1mfia_
   complexed with gol

Details for d2wkbe1

PDB Entry: 2wkb, 1.78 Å

PDB Description: crystal structure of macrophage migration inhibitory factor from plasmodium berghei

PDB Compounds: (E:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d2wkbe1:

Sequence; same for both SEQRES and ATOM records:

>d2wkbe1 d.80.1.0 (E:1-115) automated matches {Plasmodium berghei [TaxId: 5823]}
pccelitnisipddkaqntlseiedaisnilgkpvayimsnydyqknlrfsgsnegycfv
rltsigginrsnnslladkitkilsnhlsvkprrvyiefrdcsaqnfafsgslfg

Timeline for d2wkbe1:

• d2wkbe1 first appeared in SCOPe 2.01, called d2wkbe_
  
• d2wkbe1 appears in SCOPe 2.07