Lineage for d2wkbe1 (2wkb E:1-115)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2960762Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2960763Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2961445Family d.80.1.0: automated matches [191533] (1 protein)
    not a true family
  6. 2961446Protein automated matches [190903] (22 species)
    not a true protein
  7. 2961585Species Plasmodium berghei [TaxId:5823] [189095] (1 PDB entry)
  8. 2961590Domain d2wkbe1: 2wkb E:1-115 [169398]
    Other proteins in same PDB: d2wkba2, d2wkbc2, d2wkbd2, d2wkbe2, d2wkbf2
    automated match to d1mfia_
    complexed with gol

Details for d2wkbe1

PDB Entry: 2wkb (more details), 1.78 Å

PDB Description: crystal structure of macrophage migration inhibitory factor from plasmodium berghei
PDB Compounds: (E:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d2wkbe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2wkbe1 d.80.1.0 (E:1-115) automated matches {Plasmodium berghei [TaxId: 5823]}
pccelitnisipddkaqntlseiedaisnilgkpvayimsnydyqknlrfsgsnegycfv
rltsigginrsnnslladkitkilsnhlsvkprrvyiefrdcsaqnfafsgslfg

SCOPe Domain Coordinates for d2wkbe1:

Click to download the PDB-style file with coordinates for d2wkbe1.
(The format of our PDB-style files is described here.)

Timeline for d2wkbe1: