| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) ![]() |
| Family d.80.1.0: automated matches [191533] (1 protein) not a true family |
| Protein automated matches [190903] (22 species) not a true protein |
| Species Plasmodium berghei [TaxId:5823] [189095] (1 PDB entry) |
| Domain d2wkba1: 2wkb A:1-115 [169394] Other proteins in same PDB: d2wkba2, d2wkbc2, d2wkbd2, d2wkbe2, d2wkbf2 automated match to d1mfia_ complexed with gol |
PDB Entry: 2wkb (more details), 1.78 Å
SCOPe Domain Sequences for d2wkba1:
Sequence, based on SEQRES records: (download)
>d2wkba1 d.80.1.0 (A:1-115) automated matches {Plasmodium berghei [TaxId: 5823]}
pccelitnisipddkaqntlseiedaisnilgkpvayimsnydyqknlrfsgsnegycfv
rltsigginrsnnslladkitkilsnhlsvkprrvyiefrdcsaqnfafsgslfg
>d2wkba1 d.80.1.0 (A:1-115) automated matches {Plasmodium berghei [TaxId: 5823]}
pccelitnisipddkaqntlseiedaisnilgkpvayimsnydyqknlrfsgsnegycfv
rltsisnnslladkitkilsnhlsvkprrvyiefrdnfafsgslfg
Timeline for d2wkba1: