SCOPe 2.05: Domain d2wjzf_: 2wjz F:

Lineage for d2wjzf_ (2wjz F:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families)
   conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures

5. Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins)
   contains a catalytic Cys-His-Glu triad

6. Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (3 species)

7. Species Thermotoga maritima [TaxId:2336] [69448] (5 PDB entries)

8. Domain d2wjzf_: 2wjz F: [169391]
   Other proteins in same PDB: d2wjza_, d2wjzc_, d2wjze_
   automated match to d1gpwd_
   complexed with po4; mutant

Details for d2wjzf_

PDB Entry: 2wjz, 2.6 Å

PDB Description: Crystal structure of (HisH) K181A Y138A mutant of imidazoleglycerolphosphate synthase (HisH HisF) which displays constitutive glutaminase activity

PDB Compounds: (F:) imidazole glycerol phosphate synthase subunit hish

SCOPe Domain Sequences for d2wjzf_:

Sequence, based on SEQRES records:

>d2wjzf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}
mrigiisvgpgnimnlyrgvkrasenfedvsielvesprndlydllfipgvghfgegmrr
lrendlidfvrkhvederyvvgvclgmqllfeeseeapgvkglsliegnvvklrsrrlph
mgwnevifkdtfpngyyafvhtyravceeehvlgtteydgeifpsavrkgrilgfqfhpe
asskigrkllekviecsl

Sequence, based on observed residues (ATOM records):

>d2wjzf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}
mrigiisvgpgnimnlyrgvkrasenfedvsielvesprlydllfipgvghfgegmrrlr
endlidfvrkhvederyvvgvclgmqllfeeseeapgvkglsliegnvvklrsrrlphmg
wnevifkdtfpngyyafvhtyravceeehvlgtteydgeifpsavrkgrilgfqfhpeas
skigrkllekviecsl

Timeline for d2wjzf_:

• d2wjzf_ first appeared in SCOPe 2.01
  
• d2wjzf_ appears in SCOPe 2.04
  
• d2wjzf_ appears in SCOPe 2.06
  
• d2wjzf_ appears in the current release, SCOPe 2.08