Lineage for d2wjzf_ (2wjz F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2104318Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2104319Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 protein domains)
    contains a catalytic Cys-His-Glu triad
  6. 2104394Protein GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF [69447] (3 species)
  7. 2104404Species Thermotoga maritima [TaxId:2336] [69448] (6 PDB entries)
  8. 2104411Domain d2wjzf_: 2wjz F: [169391]
    Other proteins in same PDB: d2wjza_, d2wjzc_, d2wjze_
    automated match to d1gpwd_
    complexed with po4; mutant

Details for d2wjzf_

PDB Entry: 2wjz (more details), 2.6 Å

PDB Description: Crystal structure of (HisH) K181A Y138A mutant of imidazoleglycerolphosphate synthase (HisH HisF) which displays constitutive glutaminase activity
PDB Compounds: (F:) imidazole glycerol phosphate synthase subunit hish

SCOPe Domain Sequences for d2wjzf_:

Sequence, based on SEQRES records: (download)

>d2wjzf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}
mrigiisvgpgnimnlyrgvkrasenfedvsielvesprndlydllfipgvghfgegmrr
lrendlidfvrkhvederyvvgvclgmqllfeeseeapgvkglsliegnvvklrsrrlph
mgwnevifkdtfpngyyafvhtyravceeehvlgtteydgeifpsavrkgrilgfqfhpe
asskigrkllekviecsl

Sequence, based on observed residues (ATOM records): (download)

>d2wjzf_ c.23.16.1 (F:) GAT subunit, HisH, (or domain) of imidazoleglycerolphosphate synthase HisF {Thermotoga maritima [TaxId: 2336]}
mrigiisvgpgnimnlyrgvkrasenfedvsielvesprlydllfipgvghfgegmrrlr
endlidfvrkhvederyvvgvclgmqllfeeseeapgvkglsliegnvvklrsrrlphmg
wnevifkdtfpngyyafvhtyravceeehvlgtteydgeifpsavrkgrilgfqfhpeas
skigrkllekviecsl

SCOPe Domain Coordinates for d2wjzf_:

Click to download the PDB-style file with coordinates for d2wjzf_.
(The format of our PDB-style files is described here.)

Timeline for d2wjzf_: