SCOPe 2.01: Domain d2wjze_: 2wjz E:

Lineage for d2wjze_ (2wjz E:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins)
   structural evidence for the gene duplication within the barrel fold

6. Protein automated matches [190186] (3 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [186925] (3 PDB entries)

8. Domain d2wjze_: 2wjz E: [169390]
   Other proteins in same PDB: d2wjzb_, d2wjzd_, d2wjzf_
   automated match to d1gpwa_
   complexed with po4; mutant

Details for d2wjze_

PDB Entry: 2wjz, 2.6 Å

PDB Description: Crystal structure of (HisH) K181A Y138A mutant of imidazoleglycerolphosphate synthase (HisH HisF) which displays constitutive glutaminase activity

PDB Compounds: (E:) imidazole glycerol phosphate synthase hisf

SCOPe Domain Sequences for d2wjze_:

Sequence, based on SEQRES records:

>d2wjze_ c.1.2.1 (E:) automated matches {Thermotoga maritima [TaxId: 2336]}
mlakriiacldvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditasvekrk
tmlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtf
gsqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtks
gydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkey
lkkhgvnvrle

Sequence, based on observed residues (ATOM records):

>d2wjze_ c.1.2.1 (E:) automated matches {Thermotoga maritima [TaxId: 2336]}
mlakriiacldvkdgrvvgdpvelgkfyseigidelvflditakrktmlelvekvaeqid
ipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtfgsqavvvaidakrv
dgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtksgydtemirfvrplt
tlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkeylkkhgvnvrle

Timeline for d2wjze_:

• d2wjze_ is new in SCOPe 2.01-stable
  
• d2wjze_ appears in SCOPe 2.02
  
• d2wjze_ appears in the current release, SCOPe 2.08