Lineage for d1cei__ (1cei -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 
Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family) 
Family a.28.2.1: Colicin E immunity proteins [47346] (3 proteins) 
Protein ImmE7 protein (Im7) [47347] (1 species) Species Escherichia coli [TaxId:562] [47348] (4 PDB entries) 
Domain d1cei__: 1cei - [16939]
Details for d1cei__
PDB Entry: 1cei (more details), 1.8 Å
PDB Description: structure determination of the colicin e7 immunity protein (imme7) that binds specifically to the dnase-type colicin e7 and inhibits its bacteriocidal activity
SCOP Domain Sequences for d1cei__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cei__ a.28.2.1 (-) ImmE7 protein (Im7) {Escherichia coli}
lknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdnrd
dspegivkeikewraangkpgfkqg
SCOP Domain Coordinates for d1cei__:
Click to download the PDB-style file with coordinates for d1cei__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cei__:
- d1cei__ appears in SCOP 1.57
- d1cei__ appears in the current release, SCOPe 2.08, called d1ceia_
View in 3D