Lineage for d1ceia_ (1cei A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706394Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families) (S)
    automatically mapped to Pfam PF01320
  5. 2706395Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)
  6. 2706396Protein ImmE7 protein (Im7) [47347] (1 species)
  7. 2706397Species Escherichia coli [TaxId:562] [47348] (10 PDB entries)
  8. 2706402Domain d1ceia_: 1cei A: [16939]

Details for d1ceia_

PDB Entry: 1cei (more details), 1.8 Å

PDB Description: structure determination of the colicin e7 immunity protein (imme7) that binds specifically to the dnase-type colicin e7 and inhibits its bacteriocidal activity
PDB Compounds: (A:) colicin e7 immunity protein

SCOPe Domain Sequences for d1ceia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ceia_ a.28.2.1 (A:) ImmE7 protein (Im7) {Escherichia coli [TaxId: 562]}
lknsisdyteaefvqllkeiekenvaatddvldvllehfvkitehpdgtdliyypsdnrd
dspegivkeikewraangkpgfkqg

SCOPe Domain Coordinates for d1ceia_:

Click to download the PDB-style file with coordinates for d1ceia_.
(The format of our PDB-style files is described here.)

Timeline for d1ceia_: