Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) |
Family c.1.2.1: Histidine biosynthesis enzymes [51367] (3 proteins) structural evidence for the gene duplication within the barrel fold automatically mapped to Pfam PF00977 |
Protein automated matches [190186] (10 species) not a true protein |
Species Thermotoga maritima [TaxId:2336] [186925] (4 PDB entries) |
Domain d2wjzc_: 2wjz C: [169388] Other proteins in same PDB: d2wjzb_, d2wjzd_, d2wjzf_ automated match to d1gpwa_ complexed with po4; mutant |
PDB Entry: 2wjz (more details), 2.6 Å
SCOPe Domain Sequences for d2wjzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2wjzc_ c.1.2.1 (C:) automated matches {Thermotoga maritima [TaxId: 2336]} mlakriiacldvkdgrvvkgtnfenlrdsgdpvelgkfyseigidelvflditasvekrk tmlelvekvaeqidipftvgggihdfetaselilrgadkvsintaavenpslitqiaqtf gsqavvvaidakrvdgefmvftysgkkntgillrdwvvevekrgageilltsidrdgtks gydtemirfvrplttlpiiasggagkmehfleaflagadaalaasvfhfreidvrelkey lkkhgvnvrle
Timeline for d2wjzc_: